PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G273900.1.p
Common NameSETIT_012018mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 244aa    MW: 25454.8 Da    PI: 9.4803
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G273900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601301e-40591581100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C+++pyf   +p+kfa+vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l+
  Seita.7G273900.1.p  59 PCAACKLLRRRCAQECPFSPYFSPLEPHKFAAVHKVFGASNVSKMLLEVHESQRADAANSLVYEANLRLRDPVYGCMGAILTLQQQVQALE 149
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         aela++++e
  Seita.7G273900.1.p 150 AELATVRAE 158
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.39758159IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4059156IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MSTASEWPDH ELGKKIKRES ALAAADRMMT AARRSCSLPA GAGAVAGAGP GSALNTITPC  60
AACKLLRRRC AQECPFSPYF SPLEPHKFAA VHKVFGASNV SKMLLEVHES QRADAANSLV  120
YEANLRLRDP VYGCMGAILT LQQQVQALEA ELATVRAEIV RHRYRPATAS AAVATVLPSS  180
HASQLLAASA ASRGMHAGSR SVRTRTATLA AAASSSSSSA VYAAASSSTD YSSITNENVP  240
YFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-142FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977134.11e-176PREDICTED: LOB domain-containing protein 15-like
SwissprotQ9AT612e-74LBD13_ARATH; LOB domain-containing protein 13
TrEMBLK3YCR81e-173K3YCR8_SETIT; Uncharacterized protein
STRINGSi012018m1e-172(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-60LOB domain-containing protein 13